**In** **This** **Role,** **Your** **Responsibilities** **Will** **Be:** + SupportProjectManagersandIPMsinexecutingprojectcoordinationactivities. + Assistinmaintainingprojectschedules,trackers,andstatusreports. + Monitorprojectdocumentationandensurerecordsarecompleteanduptodate. + Followupwithinternalteamstotrackcustomerapprovals,documentationsubmissions,inspections,andprojectmilestones. + Supportordermanagementactivitiesbyupdatingprojectdatainbusinesssystems. + Assistinpreparingpresentations,dashboards,andprojectperformancereports. + Coordinatemeetings,captureactionitems,andtrackclosureofassignedtasks. + Helpidentifyprocessimprovementopportunitiestoenhanceprojectefficiencyandreportingaccuracy. + Ensurecompliancewithestablishedprojectmanagementprocessesanddocumentationrequirements. + Collaboratewithcross-functionalteamstosupporttimelyprojectexecutionanddelivery. **Who** **You** **Are:** You consistently focus on the highest-priority work and deliver commitments with a strong sense of accountability. You proactively seek information from multiple sources to identify trends, solve problems, and support effective decision-making. You communicate clearly and openly with diverse stakeholders while building collaborative relationships across teams. You adapt to changing priorities, learn quickly from current experiences, and continuously look for opportunities to improve processes and outcomes. **For** **This** **Role,** **You** **Will** **Need:** + PursuingaBachelor'sorMaster'sdegreeinEngineering,BusinessAdministration,ProjectManagement,Operations,orarelatedfield. + Strongorganizationalandcoordinationskills. + ProficiencyinMicrosoftExcel,PowerPoint,andotherMicrosoftOfficeapplications. + Goodwrittenandverbalcommunicationskills. + Abilitytomanagemultipletasksandmeetdeadlinesinafast-pacedenvironment. + Analyticalmindsetwithattentiontodetail. + Willingnesstolearnprojectmanagementandorderexecutionprocesses. + Abilitytoworkeffectivelybothindependentlyandwithinateamenvironment. **Preferred** **Qualifications** **That** **Set** **You** **Apart:** + Exposuretoprojectmanagementconcepts,projectcoordination,orinternshipexperience.
+ FamiliaritywithERP,projectmanagement,orreportingtools. + Knowledgeofdataanalysis,dashboardcreation,orprocessimprovementmethodologies. + Understandingofindustrialautomation,engineeringprojects,ormanufacturingenvironments. + ExperienceusingPowerBIoradvancedExcelfunctionality. **Our** **Culture** **and** **Commitment** **To** **You:** At Emerson, we foster a culture where every employee is valued, respected, and empowered to contribute their best work. We are committed to creating an inclusive environment that encourages innovation, collaboration, and continuous learning. As a PMO Intern, you will gain meaningful experience, work alongside experienced professionals, and contribute to projects that support business growth and customer success. We believe diverse perspectives strengthen our teams and help us deliver better outcomes for our customers and communities. WHY EMERSON (https://www1.emerson.com/en/corporate/careers/meet-emerson) **Our Commitment to Our People** At Emerson, we are motivated by a spirit of collaboration that helps our diverse, multicultural teams across the world drive innovation that makes the world healthier, safer, smarter, and more sustainable. And we want you to join us in our bold aspiration. We have built an engaged community of inquisitive, dedicated people who thrive knowing they are welcomed, trusted, celebrated, and empowered to solve the world's most complex problems - for our customers, our communities, and the planet. You'll contribute to this vital work while further developing your skills through our award-winning employee development programs. We are a proud corporate citizen in every city where we operate and are committed to our people, our communities, and the world at large.
We take this responsibility seriously and strive to make a positive impact through every endeavor. At Emerson, you'll see firsthand that our people are at the center of everything we do. So, let's go. Let's think differently. Learn, collaborate, and grow. Seek opportunity. Push boundaries. Be empowered to make things better. Speed up to break through. Let's go, together. **Accessibility Assistance or Accommodation** If you have a disability and are having difficulty accessing or using this website to apply for a position, please contact:
[email protected] . ABOUT EMERSON (https://www1.emerson.com/en/corporate/about-us) Emerson is a global leader in automation technology and software. Through our deep domain expertise and legacy of flawless execution, Emerson helps customers in critical industries like life sciences, energy, power and renewables, chemical and advanced factory automation operate more sustainably while improving productivity, energy security and reliability. With global operations and a comprehensive portfolio of software and technology, we are helping companies implement digital transformation to measurably improve their operations, conserve valuable resources and enhance their safety. We offer equitable opportunities, celebrate diversity, and embrace challenges with confidence that, together, we can make an impact across a broad spectrum of countries and industries. Whether you're an established professional looking for a career change, an undergraduate student exploring possibilities, or a recent graduate with an advanced degree, you'll find your chance to make a difference with Emerson. Join our team - let's go! **No calls or agencies please.** **Requisition ID** : 26009578 Emerson is an Equal Opportunity/Affirmative Action employer. All qualified applicants will receive consideration for employment without regard to sex, race, color, religion, national origin, age, marital status, political affiliation, sexual orientation, gender identity, genetic information, disability or protected veteran status. We are committed to providing a workplace free of any discrimination or harassment.
📌 Intern or Co op (India)
🏢 Emerson
📍 India